Halloween Pumpkin Carving Contest · Starts October 1st · $500 in prizes
See the contest →
+ Upload
← Back to ideas
@ai_concepts
Sep 25, 2026
Ivy Wreath and Smiling Face Etched Pumpkin DesignAI
0

Report this carving

Tell us what is wrong. Reports are private.

Ivy Wreath and Smiling Face Etched Pumpkin Design

Curling ivy leaves and a soft smiling face are etched across the rind surface in this advanced shading pumpkin carving idea, producing a striking two-tone illustration without any cut-through openings. Trace the full motif onto the skin using a transfer sheet, then use a linoleum cutter to scrape away only the orange skin along each leaf and line, revealing the pale cream flesh beneath. Work slowly around any tight ivy curl and never undercut a shape, as the thick flesh beneath every detail is what holds the design together.

No ratings yet · Sign in to rate
ExpertFacesClassicShaded / Peel
faceeasysimpleclassicshadingivyetchingtwo-tone

Comments (0)

  • No comments yet — be the first.

Save without an account. Sign in to like or comment.

Our tips for carving a similar design

The entire design lives in the surface, with no openings cut through the wall. A linoleum cutter removes the orange skin along every ivy leaf outline and the face features, leaving the pale cream flesh exposed as the illustration. Working from the outermost ivy tendrils inward prevents your hand from smudging completed sections, and never undercutting any shape keeps the flesh roof intact over each scraped area.

From pumpkin to porch

  1. Clean and surface-prep

    Wipe the pumpkin dry and let it reach room temperature before drawing on it. Cold rind tends to crack when scraped. Do not hollow the pumpkin at all for a pure etching design since the intact interior structure keeps the walls firm during the detailed scraping work.

  2. Transfer the motif

    Print the ivy wreath motif at the correct scale for your pumpkin face. Tape the transfer sheet to the surface and trace every leaf, stem, and facial feature with a stylus, pressing firmly so that the poke marks remain after the paper is removed. Remove the template and confirm all lines are visible before proceeding.

  3. Scrape the ivy leaves

    Starting with the outermost leaves, use a linoleum cutter to scrape within each leaf outline, removing only the thin orange skin layer to expose the pale flesh below. Short controlled strokes following the leaf's natural direction produce the cleanest edges. Move inward leaf by leaf, saving the most central leaves for last.

  4. Scrape the stems and tendrils

    Use the narrowest V-gouge to scrape along each stem and curling tendril. These thin lines require patience. Keep strokes short and go over each line two or three times rather than trying to remove all skin in one deep stroke. Deep cuts in narrow areas are the main source of unintended cracks.

  5. Etch the face features

    Scrape the face eyes, nose, and mouth details within the wreath center following the same shallow technique. These features should be wider and more boldly scraped than the delicate ivy lines so they read clearly from a viewing distance. Avoid undercutting any face element.

  6. Clean up and display

    Brush away any loose scraped rind with a soft dry brush or paper towel. Do not apply water since it softens the exposed flesh areas. Display in a well-lit location where raking light from the side shows off the textural depth of the two-tone illustration.

Written with AI to match this design

Gather your supplies

Check things off as you get ready.

Work on a stable surface, keep your free hand out of the cutting path, and have an adult handle sharp tools.

Three levels of light

  • Leave intact

    All orange skin surrounding the etched shapes stays fully intact as the dark background

  • Peel & shade

    Every ivy leaf, stem, tendril, and face detail: orange skin is scraped to reveal pale cream flesh

  • Cut through

    None, the shell remains fully intact throughout

Learn the carving basics

Before you start cutting

How do I handle tight ivy curls without tearing the rind?

Approach each curl from the outside of the curve inward, using the tip of the V-gouge rather than the full blade. Very short strokes of two to three millimeters give you precise control. If a curl is too tight to scrape cleanly, leave the innermost tip orange and let the visual read as a shadowed curl tip rather than forcing it.

Can I hollow the pumpkin first if I want to light it from inside?

You can, but hollow it after the scraping is complete, not before. An intact pumpkin has a rigid wall that resists the lateral scraping pressure far better than a hollowed one. Once the etching is done, cut a bottom or back hole for an LED lantern and the scraped areas will glow softly from within.

How long will the etched design stay crisp?

An uncut pumpkin typically lasts two to three weeks at room temperature. The scraped areas dry slightly faster than the surrounding rind but usually remain visible for the full display period. Keep the pumpkin out of direct rain and away from heat sources to maximize longevity.

Your take belongs here, too.

Changed a detail? Made it simpler? Share a photo of your version and tell the community what worked.

Share your pumpkin

More pumpkins like this

Sun-Face Shading Pumpkin on a Wooden Garden Bench
AI
Sun-Face Shading Pumpkin on a Wooden Garden Bench
@ai_concepts0
Cat and Moon Shading Pumpkin in Warm Candlelight
AI
Cat and Moon Shading Pumpkin in Warm Candlelight
@ai_concepts0
Black Polka Dot Pumpkin for No-Carve Beginners
AI
Black Polka Dot Pumpkin for No-Carve Beginners
@ai_concepts0
Classic Cheerful Triangle Face Pumpkin for Beginners
AI
Classic Cheerful Triangle Face Pumpkin for Beginners
@ai_concepts0
White Ghost Painted Pumpkin on a Stone Doorstep
AI
White Ghost Painted Pumpkin on a Stone Doorstep
@ai_concepts0
Star Cutout Pumpkin on a Concrete Balcony at Night
AI
Star Cutout Pumpkin on a Concrete Balcony at Night
@ai_concepts0
Leaf Wreath Pumpkin With Twenty-Four Glowing Openings
AI
Leaf Wreath Pumpkin With Twenty-Four Glowing Openings
@ai_concepts0
Radial Petal-Pattern Jack-O-Lantern With Layered Rings
AI
Radial Petal-Pattern Jack-O-Lantern With Layered Rings
@ai_concepts0
You've reached the end · 8 pumpkins
The Patch Report

Fresh pumpkins, in your inbox.

The best new carvings, ideas worth stealing, and how-tos for carving season. Short, seasonal, and gone by November.

A short email during carving season. Unsubscribe anytime. See our privacy policy.